Recombinant Human SULT1A1 protein, GST-tagged

• Cat.No.: SULT1A1-3046H
• Product Overview: Recombinant Human SULT1A1 protein(1-295 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-295 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SULT1A1 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 [ Homo sapiens ]
• Official Symbol: SULT1A1
• Synonyms: SULT1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; STP, STP1; sulfotransferase 1A1; P PST; ts-PST; P-PST 1; aryl sulfotransferase 1; thermostable phenol sulfotransferase1; phenol-sulfating phenol sulfotransferase 1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2; MGC5163; MGC131921
• Gene ID: 6817
• mRNA Refseq: NM_001055
• Protein Refseq: NP_001046
• MIM: 171150
• UniProt ID: P50225