Recombinant Human SULT1A1 protein, GST-tagged
| Cat.No. : | SULT1A1-3046H |
| Product Overview : | Recombinant Human SULT1A1 protein(1-295 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-295 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SULT1A1 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 [ Homo sapiens ] |
| Official Symbol | SULT1A1 |
| Synonyms | SULT1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; STP, STP1; sulfotransferase 1A1; P PST; ts-PST; P-PST 1; aryl sulfotransferase 1; thermostable phenol sulfotransferase1; phenol-sulfating phenol sulfotransferase 1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2; MGC5163; MGC131921; |
| Gene ID | 6817 |
| mRNA Refseq | NM_001055 |
| Protein Refseq | NP_001046 |
| MIM | 171150 |
| UniProt ID | P50225 |
| ◆ Recombinant Proteins | ||
| SULT1A1-3921H | Recombinant Human SULT1A1 protein(Glu2-Leu295), His-tagged | +Inquiry |
| SULT1A1-5289H | Recombinant Human SULT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SULT1A1-4738H | Recombinant Human SULT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SULT1A1-5487R | Recombinant Rat SULT1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SULT1A1-6377H | Recombinant Human SULT1A1 Protein (Met1-Leu295), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
| SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1A1 Products
Required fields are marked with *
My Review for All SULT1A1 Products
Required fields are marked with *
