Recombinant Human SULT1A1 protein, His-tagged
Cat.No. : | SULT1A1-2830H |
Product Overview : | Recombinant Human SULT1A1 protein(1-295 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-295 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SULT1A1 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 [ Homo sapiens ] |
Official Symbol | SULT1A1 |
Synonyms | SULT1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; STP, STP1; sulfotransferase 1A1; P PST; ts-PST; P-PST 1; aryl sulfotransferase 1; thermostable phenol sulfotransferase1; phenol-sulfating phenol sulfotransferase 1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2; MGC5163; MGC131921; |
Gene ID | 6817 |
mRNA Refseq | NM_001055 |
Protein Refseq | NP_001046 |
MIM | 171150 |
UniProt ID | P50225 |
◆ Recombinant Proteins | ||
SULT1A1-5828R | Recombinant Rat SULT1A1 Protein | +Inquiry |
Sult1a1-3542M | Recombinant Mouse Sult1a1 protein, His-SUMO & Myc-tagged | +Inquiry |
SULT1A1-6376H | Recombinant Human SULT1A1 Protein (Glu2-Leu295), His tagged | +Inquiry |
Sult1a1-6750R | Recombinant Rat Sult1a1 protein, His-tagged | +Inquiry |
Sult1a1-1379R | Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SULT1A1 Products
Required fields are marked with *
My Review for All SULT1A1 Products
Required fields are marked with *
0
Inquiry Basket