Recombinant Human SULT1A3 Protein, HIS-tagged

• Cat.No.: SULT1A3-112H
• Product Overview: Recombinant Human SULT1A3 fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containing GIY-YIG domains.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0
• Molecular Mass: 35.6kD
• AA Sequence: MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVP
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: SULT1A3 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 [ Homo sapiens ]
• Official Symbol: SULT1A3
• Synonyms: SULT1A3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; STM; sulfotransferase 1A3/1A4; TL PST; sulfokinase; phenol sulfotransferase 1A5; aryl sulfotransferase 1A3/1A4; dopamine-specific sulfotransferase; placental estrogen sulfotransferase; monoamine-sulfating phenosulfotransferase; catecholamine-sulfating phenol sulfotransferase; thermolabile (monoamine, M form) phenol sulfotransferase; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4; MGC117469
• Gene ID: 6818
• mRNA Refseq: NM_177552
• Protein Refseq: NP_808220
• MIM: 600641
• UniProt ID: P50224