Recombinant Human SULT1A4 protein, GST-tagged

• Cat.No.: SULT1A4-3047H
• Product Overview: Recombinant Human SULT1A4 protein(1-295 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-295 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SULT1A4
• Synonyms: SULT1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4; GALPHA; MTDPS9; SUCLA1; succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; SCS-alpha; succinyl-CoA synthetase subunit alpha; succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial; Aryl Sulfotransferase 1A3/1A4; Catecholamine-Sulfating Phenol Sulfotransferase; Monoamine-Sulfating Phenol Sulfotransferase; Placental Estrogen Sulfotransferase; Sulfotransferase, Monoamine-Preferring; Thermolabile Phenol Sulfotransferase; HAST3; M-PST; ST1A3/ST1A4; TL-PST; EC 2.8.2.1; sulfokinase; Sulfotransferase 1A3/1A4; STM; EC 2.8.2
• Gene ID: 445329
• mRNA Refseq: NM_001017390
• Protein Refseq: NP_001017390
• UniProt ID: P50224