Recombinant Human SULT1B1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SULT1B1-1783H
Product Overview : SULT1B1 MS Standard C13 and N15-labeled recombinant protein (NP_055280) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes.
Molecular Mass : 34.9 kDa
AA Sequence : MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SULT1B1 sulfotransferase family 1B member 1 [ Homo sapiens (human) ]
Official Symbol SULT1B1
Synonyms SULT1B1; sulfotransferase family, cytosolic, 1B, member 1; sulfotransferase family cytosolic 1B member 1; ST1B2; sulfotransferase 1B1; sulfotransferase 1B2; thyroid hormone sulfotransferase; ST1B1; SULT1B2; MGC13356;
Gene ID 27284
mRNA Refseq NM_014465
Protein Refseq NP_055280
MIM 608436
UniProt ID O43704

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SULT1B1 Products

Required fields are marked with *

My Review for All SULT1B1 Products

Required fields are marked with *

0
cart-icon
0
compare icon