Recombinant Human SULT1B1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SULT1B1-1783H |
| Product Overview : | SULT1B1 MS Standard C13 and N15-labeled recombinant protein (NP_055280) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. |
| Molecular Mass : | 34.9 kDa |
| AA Sequence : | MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SULT1B1 sulfotransferase family 1B member 1 [ Homo sapiens (human) ] |
| Official Symbol | SULT1B1 |
| Synonyms | SULT1B1; sulfotransferase family, cytosolic, 1B, member 1; sulfotransferase family cytosolic 1B member 1; ST1B2; sulfotransferase 1B1; sulfotransferase 1B2; thyroid hormone sulfotransferase; ST1B1; SULT1B2; MGC13356; |
| Gene ID | 27284 |
| mRNA Refseq | NM_014465 |
| Protein Refseq | NP_055280 |
| MIM | 608436 |
| UniProt ID | O43704 |
| ◆ Recombinant Proteins | ||
| Sult1b1-6221M | Recombinant Mouse Sult1b1 Protein, Myc/DDK-tagged | +Inquiry |
| SULT1B1-972H | Active Recombinant Human SULT1B1 protein, His-tagged | +Inquiry |
| SULT1B1-3048H | Recombinant Human SULT1B1, GST-tagged | +Inquiry |
| SULT1B1-90H | Active Recombinant Human SULT1B1 Protein | +Inquiry |
| SULT1B1-5813H | Recombinant Human SULT1B1 Protein (Met1-Ile296), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULT1B1-1352HCL | Recombinant Human SULT1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1B1 Products
Required fields are marked with *
My Review for All SULT1B1 Products
Required fields are marked with *
