Recombinant Human SULT2B1 protein, GST-tagged
| Cat.No. : | SULT2B1-301465H |
| Product Overview : | Recombinant Human SULT2B1 (283-365 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asn283-Ser365 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | NHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SULT2B1 sulfotransferase family, cytosolic, 2B, member 1 [ Homo sapiens ] |
| Official Symbol | SULT2B1 |
| Synonyms | SULT2B1; sulfotransferase family, cytosolic, 2B, member 1; sulfotransferase family cytosolic 2B member 1; HSST2; ST2B1; sulfotransferase 2B1; alcohol sulfotransferase; hydroxysteroid sulfotransferase 2; |
| Gene ID | 6820 |
| mRNA Refseq | NM_004605 |
| Protein Refseq | NP_004596 |
| MIM | 604125 |
| UniProt ID | O00204 |
| ◆ Recombinant Proteins | ||
| SULT2B1-3902H | Recombinant Human SULT2B1 protein(Asp2-Ser365), His-tagged | +Inquiry |
| SULT2B1-181H | Recombinant Human SULT2B1 Protein, His-tagged | +Inquiry |
| SULT2B1-8866M | Recombinant Mouse SULT2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SULT2B1-2046H | Recombinant Human SULT2B1, His-tagged | +Inquiry |
| SULT2B1-1473H | Recombinant Human Sulfotransferase Family, Cytosolic, 2B, Member 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULT2B1-1348HCL | Recombinant Human SULT2B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT2B1 Products
Required fields are marked with *
My Review for All SULT2B1 Products
Required fields are marked with *



