Recombinant Human SULT2B1 protein, GST-tagged
Cat.No. : | SULT2B1-301465H |
Product Overview : | Recombinant Human SULT2B1 (283-365 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn283-Ser365 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SULT2B1 sulfotransferase family, cytosolic, 2B, member 1 [ Homo sapiens ] |
Official Symbol | SULT2B1 |
Synonyms | SULT2B1; sulfotransferase family, cytosolic, 2B, member 1; sulfotransferase family cytosolic 2B member 1; HSST2; ST2B1; sulfotransferase 2B1; alcohol sulfotransferase; hydroxysteroid sulfotransferase 2; |
Gene ID | 6820 |
mRNA Refseq | NM_004605 |
Protein Refseq | NP_004596 |
MIM | 604125 |
UniProt ID | O00204 |
◆ Recombinant Proteins | ||
SULT2B1-301465H | Recombinant Human SULT2B1 protein, GST-tagged | +Inquiry |
SULT2B1-3546H | Recombinant Human SULT2B1 protein, GST-tagged | +Inquiry |
SULT2B1-16231M | Recombinant Mouse SULT2B1 Protein | +Inquiry |
SULT2B1-6379H | Recombinant Human SULT2B1 Protein (Met1-Glu311), C-His tagged | +Inquiry |
Sult2b1-6222M | Recombinant Mouse Sult2b1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT2B1-1348HCL | Recombinant Human SULT2B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT2B1 Products
Required fields are marked with *
My Review for All SULT2B1 Products
Required fields are marked with *