Recombinant Human SULT4A1

Cat.No. : SULT4A1-199H
Product Overview : Recombinant Human Sulfotransferase 4A1/SULT4A1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu284) of Human SULT4A1.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-284 a.a.
Description : Sulfotransferase 4A1 (ST4A1) is a member of the Sulfotransferase 1 family. ST4A1 is highly expressed in the cerebral cortex and frontal lobe, but no expression is detected in the pancreas. ST4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. ST4A1 acts on catecholamines and T4 in a manner that may not involve sulfonation. ST4A1 may have a role in the metabolism of drugs and neurotransmitters in the CNS. In addition, ST4A1 is related to schizophrenia.
Form : Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
AA Sequence : MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVV YLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIY MARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLK YEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVS MNEKFDLVYKQKMGKCDLTFDFYL
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name SULT4A1 sulfotransferase family 4A, member 1 [ Homo sapiens ]
Official Symbol SULT4A1
Synonyms SULT4A1; sulfotransferase family 4A, member 1; sulfotransferase 4A1; hBR STL 1; SULTX3; ST4A1; hBR-STL; nervous system sulfotransferase; sulfotransferase-related protein; brain sulfotransferase-like protein; nervous system cytosolic sulfotransferase; NST; BRSTL1; BR-STL-1; DJ388M5.3; hBR-STL-1; MGC40032;
Gene ID 25830
mRNA Refseq NM_014351
Protein Refseq NP_055166
MIM 608359
UniProt ID Q9BR01
Chromosome Location 22q13.2
Pathway Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem;
Function sulfotransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SULT4A1 Products

Required fields are marked with *

My Review for All SULT4A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon