Recombinant Human SULT4A1
| Cat.No. : | SULT4A1-199H |
| Product Overview : | Recombinant Human Sulfotransferase 4A1/SULT4A1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu284) of Human SULT4A1. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-284 a.a. |
| Description : | Sulfotransferase 4A1 (ST4A1) is a member of the Sulfotransferase 1 family. ST4A1 is highly expressed in the cerebral cortex and frontal lobe, but no expression is detected in the pancreas. ST4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. ST4A1 acts on catecholamines and T4 in a manner that may not involve sulfonation. ST4A1 may have a role in the metabolism of drugs and neurotransmitters in the CNS. In addition, ST4A1 is related to schizophrenia. |
| Form : | Supplied as a 0.2 μM filtered solution of PBS, pH 7.4 |
| AA Sequence : | MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVV YLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIY MARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLK YEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVS MNEKFDLVYKQKMGKCDLTFDFYL |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Store at Please minimize freeze-thaw cycles. |
| Gene Name | SULT4A1 sulfotransferase family 4A, member 1 [ Homo sapiens ] |
| Official Symbol | SULT4A1 |
| Synonyms | SULT4A1; sulfotransferase family 4A, member 1; sulfotransferase 4A1; hBR STL 1; SULTX3; ST4A1; hBR-STL; nervous system sulfotransferase; sulfotransferase-related protein; brain sulfotransferase-like protein; nervous system cytosolic sulfotransferase; NST; BRSTL1; BR-STL-1; DJ388M5.3; hBR-STL-1; MGC40032; |
| Gene ID | 25830 |
| mRNA Refseq | NM_014351 |
| Protein Refseq | NP_055166 |
| MIM | 608359 |
| UniProt ID | Q9BR01 |
| Chromosome Location | 22q13.2 |
| Pathway | Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; |
| Function | sulfotransferase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| SULT4A1-3052H | Recombinant Human SULT4A1 protein, His-tagged | +Inquiry |
| SULT4A1-3731Z | Recombinant Zebrafish SULT4A1 | +Inquiry |
| SULT4A1-3968H | Recombinant Human SULT4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SULT4A1-301455H | Recombinant Human SULT4A1 protein, GST-tagged | +Inquiry |
| SULT4A1-199H | Recombinant Human SULT4A1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULT4A1-1347HCL | Recombinant Human SULT4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT4A1 Products
Required fields are marked with *
My Review for All SULT4A1 Products
Required fields are marked with *
