Recombinant Human SULT4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SULT4A1-3968H
Product Overview : SULT4A1 MS Standard C13 and N15-labeled recombinant protein (NP_055166) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia.
Molecular Mass : 33 kDa
AA Sequence : MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPPGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SULT4A1 sulfotransferase family 4A member 1 [ Homo sapiens (human) ]
Official Symbol SULT4A1
Synonyms SULT4A1; sulfotransferase family 4A, member 1; sulfotransferase 4A1; hBR STL 1; SULTX3; ST4A1; hBR-STL; nervous system sulfotransferase; sulfotransferase-related protein; brain sulfotransferase-like protein; nervous system cytosolic sulfotransferase; NST; BRSTL1; BR-STL-1; DJ388M5.3; hBR-STL-1; MGC40032;
Gene ID 25830
mRNA Refseq NM_014351
Protein Refseq NP_055166
MIM 608359
UniProt ID Q9BR01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SULT4A1 Products

Required fields are marked with *

My Review for All SULT4A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon