Recombinant Human SUMF2 protein, GST-tagged
Cat.No. : | SUMF2-33H |
Product Overview : | Recombinant Human SUMF2(26 a.a. - 125 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 26 a.a. - 125 a.a. |
Description : | The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SUMF2 sulfatase modifying factor 2 [ Homo sapiens ] |
Official Symbol | SUMF2 |
Synonyms | SUMF2; sulfatase modifying factor 2; sulfatase-modifying factor 2; DKFZp566I1024; C-alpha-formyglycine-generating enzyme 2; C-alpha-formylglycine-generating enzyme 2; paralog of the formylglycine-generating enzyme; pFGE; MGC99485; DKFZp686I1024; DKFZp781L1035; DKFZp686L17160; |
Gene ID | 25870 |
mRNA Refseq | NM_015411 |
Protein Refseq | NP_056226 |
MIM | 607940 |
UniProt ID | Q8NBJ7 |
Chromosome Location | 7q11.1 |
Function | binding; metal ion binding; |
◆ Recombinant Proteins | ||
SUMF2-33H | Recombinant Human SUMF2 protein, GST-tagged | +Inquiry |
SUMF2-608HF | Recombinant Full Length Human SUMF2 Protein, GST-tagged | +Inquiry |
Sumf2-6223M | Recombinant Mouse Sumf2 Protein, Myc/DDK-tagged | +Inquiry |
SUMF2-3055H | Recombinant Human SUMF2 protein, MYC/DDK-tagged | +Inquiry |
SUMF2-4154H | Recombinant Human SUMF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMF2-1345HCL | Recombinant Human SUMF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMF2 Products
Required fields are marked with *
My Review for All SUMF2 Products
Required fields are marked with *