Recombinant Human SUMO1 protein(1-97 aa), C-His-tagged
Cat.No. : | SUMO1-2874H |
Product Overview : | Recombinant Human SUMO1 protein(P63165)(1-97 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-97 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG |
Gene Name | SUMO1 SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUMO1 |
Synonyms | SUMO1; SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 1 (yeast) , ubiquitin like 1 (sentrin) , UBL1; small ubiquitin-related modifier 1; GMP1; OFC10; PIC1; SMT3C; SMT3H3; SUMO 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; ubiquitin-homology domain protein PIC1; DAP1; SMT3; UBL1; SENP2; |
Gene ID | 7341 |
mRNA Refseq | NM_001005781 |
Protein Refseq | NP_001005781 |
MIM | 601912 |
UniProt ID | P63165 |
◆ Recombinant Proteins | ||
SUMO1-249H | Recombinant Human SUMO1, His-tagged | +Inquiry |
SUMO1-568H | Active Recombinant Human SUMO1 | +Inquiry |
SUMO1-3054H | Recombinant Human SUMO1 protein, GST-tagged | +Inquiry |
SUMO1-1247H | Recombinant Human SUMO1 protein, GST-tagged | +Inquiry |
SUMO1-20H | Recombinant Human Small Ubiquitin-related Modifier 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMO1-1344HCL | Recombinant Human SUMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUMO1 Products
Required fields are marked with *
My Review for All SUMO1 Products
Required fields are marked with *
0
Inquiry Basket