Recombinant Human SUMO1 protein(1-97 aa), C-His-tagged

Cat.No. : SUMO1-2874H
Product Overview : Recombinant Human SUMO1 protein(P63165)(1-97 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-97 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Gene Name SUMO1 SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUMO1
Synonyms SUMO1; SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 1 (yeast) , ubiquitin like 1 (sentrin) , UBL1; small ubiquitin-related modifier 1; GMP1; OFC10; PIC1; SMT3C; SMT3H3; SUMO 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; ubiquitin-homology domain protein PIC1; DAP1; SMT3; UBL1; SENP2;
Gene ID 7341
mRNA Refseq NM_001005781
Protein Refseq NP_001005781
MIM 601912
UniProt ID P63165

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUMO1 Products

Required fields are marked with *

My Review for All SUMO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon