Recombinant Human SUMO1 protein, His-tagged
| Cat.No. : | SUMO1-3385H |
| Product Overview : | Recombinant Human SUMO1 protein(3-101 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3-101 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SUMO1 SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUMO1 |
| Synonyms | SUMO1; SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 1 (yeast) , ubiquitin like 1 (sentrin) , UBL1; small ubiquitin-related modifier 1; GMP1; OFC10; PIC1; SMT3C; SMT3H3; SUMO 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; ubiquitin-homology domain protein PIC1; DAP1; SMT3; UBL1; SENP2; |
| Gene ID | 7341 |
| mRNA Refseq | NM_001005781 |
| Protein Refseq | NP_001005781 |
| MIM | 601912 |
| UniProt ID | P63165 |
| ◆ Recombinant Proteins | ||
| SUMO1-558H | Active Recombinant Human SUMO1 | +Inquiry |
| SUMO1-561H | Active Recombinant Human SUMO1, His-tagged | +Inquiry |
| SUMO1-8870M | Recombinant Mouse SUMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUMO1-4560R | Recombinant Rhesus monkey SUMO1 Protein, His-tagged | +Inquiry |
| SUMO1-3455H | Recombinant Human SUMO1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUMO1-1344HCL | Recombinant Human SUMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMO1 Products
Required fields are marked with *
My Review for All SUMO1 Products
Required fields are marked with *
