Recombinant Human SUMO1 protein, His-tagged

• Cat.No.: SUMO1-3385H
• Product Overview: Recombinant Human SUMO1 protein(3-101 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 3-101 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SUMO1 SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUMO1
• Synonyms: SUMO1; SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 1 (yeast) , ubiquitin like 1 (sentrin) , UBL1; small ubiquitin-related modifier 1; GMP1; OFC10; PIC1; SMT3C; SMT3H3; SUMO 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; ubiquitin-homology domain protein PIC1; DAP1; SMT3; UBL1; SENP2
• Gene ID: 7341
• mRNA Refseq: NM_001005781
• Protein Refseq: NP_001005781
• MIM: 601912
• UniProt ID: P63165