Recombinant Human SUMO1 protein, His-tagged
Cat.No. : | SUMO1-3385H |
Product Overview : | Recombinant Human SUMO1 protein(3-101 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-101 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SUMO1 SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUMO1 |
Synonyms | SUMO1; SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 1 (yeast) , ubiquitin like 1 (sentrin) , UBL1; small ubiquitin-related modifier 1; GMP1; OFC10; PIC1; SMT3C; SMT3H3; SUMO 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; ubiquitin-homology domain protein PIC1; DAP1; SMT3; UBL1; SENP2; |
Gene ID | 7341 |
mRNA Refseq | NM_001005781 |
Protein Refseq | NP_001005781 |
MIM | 601912 |
UniProt ID | P63165 |
◆ Recombinant Proteins | ||
SUMO1-249H | Recombinant Human SUMO1, His-tagged | +Inquiry |
SUMO1-559H | Active Recombinant Human SUMO1, HA (YPYDVPDYA)-tagged | +Inquiry |
SUM01-12H | Recombinant Human SUMO1 | +Inquiry |
SUMO1-1293H | Recombinant Human SMT3 Suppressor Of Mif Two 3 Homolog 1 (S. Cerevisiae), His-tagged | +Inquiry |
SUMO1-3455H | Recombinant Human SUMO1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMO1-1344HCL | Recombinant Human SUMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUMO1 Products
Required fields are marked with *
My Review for All SUMO1 Products
Required fields are marked with *
0
Inquiry Basket