Recombinant Human SUMO3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SUMO3-709H |
| Product Overview : | SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. |
| Molecular Mass : | 11.6 kDa |
| AA Sequence : | MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SUMO3 small ubiquitin like modifier 3 [ Homo sapiens (human) ] |
| Official Symbol | SUMO3 |
| Synonyms | SUMO3; SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 1, SMT3 suppressor of mif two 3 homolog 3 (yeast), SMT3H1; small ubiquitin-related modifier 3; SMT3A; SUMO-2; SMT3 homolog 1; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; SMT3 suppressor of mif two 3 homolog 1; Smt3B; SMT3H1; SUMO-3; |
| Gene ID | 6612 |
| mRNA Refseq | NM_006936 |
| Protein Refseq | NP_008867 |
| MIM | 602231 |
| UniProt ID | P55854 |
| ◆ Recombinant Proteins | ||
| SUMO3-2743H | Recombinant Full Length Human SUMO3 Protein, His-tagged | +Inquiry |
| SUMO3-4562R | Recombinant Rhesus monkey SUMO3 Protein, His-tagged | +Inquiry |
| SUMO3-1338S | Recombinant Human SUMO3 Protein (S2-F103), Tag Free | +Inquiry |
| SUMO3-581H | Active Recombinant Human SUMO3 | +Inquiry |
| SUMO3-208H | Recombinant Human Sentrin-2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUMO3-1343HCL | Recombinant Human SUMO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMO3 Products
Required fields are marked with *
My Review for All SUMO3 Products
Required fields are marked with *
