Recombinant Human SUMO4 protein, GST-tagged

• Cat.No.: SUMO4-4514H
• Product Overview: Recombinant Human SUMO4 protein(Q6EEV6)(1-95aa), fused to N-terminal GST tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-95aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.7 kDa
• AA Sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SUMO4 SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUMO4
• Synonyms: SUMO4; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 4 (yeast) , SMT3H4; small ubiquitin-related modifier 4; dJ281H8.4; SMT3 suppressor of mif two 3 homolog 2; small ubiquitin-like modifier 4 protein; IDDM5; SMT3H4; SUMO-4
• Gene ID: 387082
• mRNA Refseq: NM_001002255
• Protein Refseq: NP_001002255
• MIM: 608829
• UniProt ID: Q6EEV6