Recombinant Human SWAP70, GST-tagged

Cat.No. : SWAP70-97H
Product Overview : Recombinant Human SWAP70(378 a.a. - 451 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Switch-associated protein 70 is a protein that in humans and other mammals is encoded by the SWAP70 gene.
Molecular Mass : 33.88 kDa
AA Sequence : QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SWAP70 SWAP switching B-cell complex 70kDa subunit [ Homo sapiens ]
Official Symbol SWAP70
Synonyms SWAP70; SWAP switching B-cell complex 70kDa subunit; switch-associated protein 70; KIAA0640; SWAP 70; HSPC321; SWAP-70; FLJ39540
Gene ID 23075
mRNA Refseq NM_015055
Protein Refseq NP_055870
MIM 604762
UniProt ID Q9UH65
Chromosome Location 11p15
Function ATP binding; DNA binding; calcium ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SWAP70 Products

Required fields are marked with *

My Review for All SWAP70 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon