Recombinant Human SYCE2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYCE2-1428H |
Product Overview : | SYCE2 MS Standard C13 and N15-labeled recombinant protein (NP_001099048) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. |
Molecular Mass : | 24.5 kDa |
AA Sequence : | MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEVQTNRDGECTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYCE2 synaptonemal complex central element protein 2 [ Homo sapiens (human) ] |
Official Symbol | SYCE2 |
Synonyms | SYCE2; synaptonemal complex central element protein 2; central element synaptonemal complex 1; CESC1; central element synaptonemal complex protein 1; |
Gene ID | 256126 |
mRNA Refseq | NM_001105578 |
Protein Refseq | NP_001099048 |
MIM | 611487 |
UniProt ID | Q6PIF2 |
◆ Recombinant Proteins | ||
SYCE2-2701Z | Recombinant Zebrafish SYCE2 | +Inquiry |
SYCE2-8904M | Recombinant Mouse SYCE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYCE2-16292M | Recombinant Mouse SYCE2 Protein | +Inquiry |
SYCE2-1428H | Recombinant Human SYCE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYCE2-3082H | Recombinant Human SYCE2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYCE2 Products
Required fields are marked with *
My Review for All SYCE2 Products
Required fields are marked with *