Recombinant Human SYCE2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SYCE2-1428H
Product Overview : SYCE2 MS Standard C13 and N15-labeled recombinant protein (NP_001099048) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed.
Molecular Mass : 24.5 kDa
AA Sequence : MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEVQTNRDGECTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SYCE2 synaptonemal complex central element protein 2 [ Homo sapiens (human) ]
Official Symbol SYCE2
Synonyms SYCE2; synaptonemal complex central element protein 2; central element synaptonemal complex 1; CESC1; central element synaptonemal complex protein 1;
Gene ID 256126
mRNA Refseq NM_001105578
Protein Refseq NP_001099048
MIM 611487
UniProt ID Q6PIF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYCE2 Products

Required fields are marked with *

My Review for All SYCE2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon