Recombinant Full Length Human SYCE2 Protein, C-Flag-tagged
Cat.No. : | SYCE2-825HFL |
Product Overview : | Recombinant Full Length Human SYCE2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.5 kDa |
AA Sequence : | MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDIL QKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKIS HLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEV QTNRDGECTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SYCE2 synaptonemal complex central element protein 2 [ Homo sapiens (human) ] |
Official Symbol | SYCE2 |
Synonyms | CESC1 |
Gene ID | 256126 |
mRNA Refseq | NM_001105578.2 |
Protein Refseq | NP_001099048.1 |
MIM | 611487 |
UniProt ID | Q6PIF2 |
◆ Recombinant Proteins | ||
SYCE2-3082H | Recombinant Human SYCE2 Protein, MYC/DDK-tagged | +Inquiry |
SYCE2-1428H | Recombinant Human SYCE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYCE2-825HFL | Recombinant Full Length Human SYCE2 Protein, C-Flag-tagged | +Inquiry |
SYCE2-2701Z | Recombinant Zebrafish SYCE2 | +Inquiry |
Syce2-6240M | Recombinant Mouse Syce2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYCE2 Products
Required fields are marked with *
My Review for All SYCE2 Products
Required fields are marked with *