Recombinant Human SYF2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SYF2-5101H |
| Product Overview : | SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Molecular Mass : | 28.7 kDa |
| AA Sequence : | MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SYF2 SYF2 pre-mRNA splicing factor [ Homo sapiens (human) ] |
| Official Symbol | SYF2 |
| Synonyms | SYF2; SYF2 homolog, RNA splicing factor (S. cerevisiae); CBPIN, CCNDBP1 interactor; pre-mRNA-splicing factor SYF2; DKFZp564O2082; fSAP29; functional spliceosome associated protein 29; NTC31; p29; CCNDBP1 interactor; CCNDBP1-interactor; GCIP-interacting protein p29; functional spliceosome-associated protein 29; P29; CBPIN; |
| Gene ID | 25949 |
| mRNA Refseq | NM_015484 |
| Protein Refseq | NP_056299 |
| MIM | 607090 |
| UniProt ID | O95926 |
| ◆ Recombinant Proteins | ||
| SYF2-4615C | Recombinant Chicken SYF2 | +Inquiry |
| SYF2-5517R | Recombinant Rat SYF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYF2-887Z | Recombinant Zebrafish SYF2 | +Inquiry |
| SYF2-3068H | Recombinant Human SYF2, His-tagged | +Inquiry |
| SYF2-5858R | Recombinant Rat SYF2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYF2-1321HCL | Recombinant Human SYF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYF2 Products
Required fields are marked with *
My Review for All SYF2 Products
Required fields are marked with *
