Recombinant Human SYF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SYF2-5101H
• Product Overview: SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Molecular Mass: 28.7 kDa
• AA Sequence: MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SYF2 SYF2 pre-mRNA splicing factor [ Homo sapiens (human) ]
• Official Symbol: SYF2
• Synonyms: SYF2; SYF2 homolog, RNA splicing factor (S. cerevisiae); CBPIN, CCNDBP1 interactor; pre-mRNA-splicing factor SYF2; DKFZp564O2082; fSAP29; functional spliceosome associated protein 29; NTC31; p29; CCNDBP1 interactor; CCNDBP1-interactor; GCIP-interacting protein p29; functional spliceosome-associated protein 29; P29; CBPIN
• Gene ID: 25949
• mRNA Refseq: NM_015484
• Protein Refseq: NP_056299
• MIM: 607090
• UniProt ID: O95926