Recombinant Human SYF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SYF2-5101H
Product Overview : SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Mass : 28.7 kDa
AA Sequence : MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SYF2 SYF2 pre-mRNA splicing factor [ Homo sapiens (human) ]
Official Symbol SYF2
Synonyms SYF2; SYF2 homolog, RNA splicing factor (S. cerevisiae); CBPIN, CCNDBP1 interactor; pre-mRNA-splicing factor SYF2; DKFZp564O2082; fSAP29; functional spliceosome associated protein 29; NTC31; p29; CCNDBP1 interactor; CCNDBP1-interactor; GCIP-interacting protein p29; functional spliceosome-associated protein 29; P29; CBPIN;
Gene ID 25949
mRNA Refseq NM_015484
Protein Refseq NP_056299
MIM 607090
UniProt ID O95926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYF2 Products

Required fields are marked with *

My Review for All SYF2 Products

Required fields are marked with *

0
cart-icon