Recombinant Human SYN1 Protein, His-tagged
Cat.No. : | SYN1-6386H |
Product Overview : | Recombinant Human SYN1 protein(Gly160-Ile291), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gly160-Ile291 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose. |
Molecular Mass : | The protein has a calculated MW of 17 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.8 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDI |
Gene Name | SYN1 synapsin I [ Homo sapiens ] |
Official Symbol | SYN1 |
Synonyms | SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b; |
Gene ID | 6853 |
mRNA Refseq | NM_006950 |
Protein Refseq | NP_008881 |
MIM | 313440 |
UniProt ID | P17600 |
◆ Recombinant Proteins | ||
SYN1-5860R | Recombinant Rat SYN1 Protein | +Inquiry |
Syn1-7854R | Recombinant Rat Syn1 protein, His-tagged | +Inquiry |
Syn1-8136M | Recombinant Mouse Syn1 protein, His & T7-tagged | +Inquiry |
Syn1-646R | Recombinant Rat Syn1 protein, His-tagged | +Inquiry |
SYN1-6386H | Recombinant Human SYN1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYN1 Products
Required fields are marked with *
My Review for All SYN1 Products
Required fields are marked with *
0
Inquiry Basket