Recombinant Human SYN1 Protein, His-tagged

Cat.No. : SYN1-6386H
Product Overview : Recombinant Human SYN1 protein(Gly160-Ile291), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Gly160-Ile291
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
Molecular Mass : The protein has a calculated MW of 17 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.8 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDI
Gene Name SYN1 synapsin I [ Homo sapiens ]
Official Symbol SYN1
Synonyms SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b;
Gene ID 6853
mRNA Refseq NM_006950
Protein Refseq NP_008881
MIM 313440
UniProt ID P17600

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYN1 Products

Required fields are marked with *

My Review for All SYN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon