Recombinant Human SYN1 Protein, His-tagged

• Cat.No.: SYN1-6386H
• Product Overview: Recombinant Human SYN1 protein(Gly160-Ile291), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Gly160-Ile291
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose.
• Molecular Mass: The protein has a calculated MW of 17 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.8 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDI

Gene Information

• Gene Name: SYN1 synapsin I [ Homo sapiens ]
• Official Symbol: SYN1
• Synonyms: SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b
• Gene ID: 6853
• mRNA Refseq: NM_006950
• Protein Refseq: NP_008881
• MIM: 313440
• UniProt ID: P17600