Recombinant Human synaptic vesicle glycoprotein 2A Protein, GST tagged
Cat.No. : | SV2A-03H |
Product Overview : | Human SV2A partial ORF ( NP_055664, 474 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons. |
Tag : | N-GST |
Molecular Mass : | 32.01 kDa |
AA Sequence : | HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SV2A synaptic vesicle glycoprotein 2A [ Homo sapiens (human) ] |
Official Symbol | SV2A |
Synonyms | SV2A; synaptic vesicle glycoprotein 2A; KIAA0736; SV2 |
Gene ID | 9900 |
mRNA Refseq | NM_014849 |
Protein Refseq | NP_055664 |
MIM | 185860 |
UniProt ID | Q7L0J3 |
◆ Recombinant Proteins | ||
SV2A-5068B | Recombinant Bovine SV2A protein, His&Myc-tagged | +Inquiry |
SV2A-736C | Recombinant Cynomolgus Monkey SV2A Protein, His (Fc)-Avi-tagged | +Inquiry |
SV2A-2274B | Recombinant Bovine SV2A Protein (1-169 aa), His-Myc-tagged | +Inquiry |
SV2A-16266M | Recombinant Mouse SV2A Protein | +Inquiry |
SV2A-4533B | Recombinant Bovine SV2A protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SV2A-1329HCL | Recombinant Human SV2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SV2A Products
Required fields are marked with *
My Review for All SV2A Products
Required fields are marked with *