Recombinant Human synaptic vesicle glycoprotein 2A Protein, GST tagged

• Cat.No.: SV2A-03H
• Product Overview: Human SV2A partial ORF ( NP_055664, 474 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons.
• Tag: N-GST
• Molecular Mass: 32.01 kDa
• AA Sequence: HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SV2A synaptic vesicle glycoprotein 2A [ Homo sapiens (human) ]
• Official Symbol: SV2A
• Synonyms: SV2A; synaptic vesicle glycoprotein 2A; KIAA0736; SV2
• Gene ID: 9900
• mRNA Refseq: NM_014849
• Protein Refseq: NP_055664
• MIM: 185860
• UniProt ID: Q7L0J3