Recombinant Human SYNGR1 Protein (1-191 aa), GST-tagged

• Cat.No.: SYNGR1-2126H
• Product Overview: Recombinant Human SYNGR1 Protein (1-191 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Isoform 1B.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-191 aa
• Description: Involved in the regulation of short-term and long-term synaptic plasticity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 48.0 kDa
• AA Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SYNGR1 synaptogyrin 1 [ Homo sapiens ]
• Official Symbol: SYNGR1
• Synonyms: SYNGR1
• Gene ID: 9145
• mRNA Refseq: NM_145738.2
• Protein Refseq: NP_663791.1
• MIM: 603925
• UniProt ID: O43759