Recombinant Human SYNGR2 protein, His-tagged

• Cat.No.: SYNGR2-4708H
• Product Overview: Recombinant Human SYNGR2 protein(O43760)(168-224 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 168-224 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 8.4 kDa
• AASequence: QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SYNGR2 synaptogyrin 2 [ Homo sapiens ]
• Official Symbol: SYNGR2
• Synonyms: SYNGR2; synaptogyrin 2; synaptogyrin-2; cellugyrin; MGC102914
• Gene ID: 9144
• mRNA Refseq: NM_004710
• Protein Refseq: NP_004701
• MIM: 603926
• UniProt ID: O43760