Recombinant Human SYNGR2 protein, His-tagged
Cat.No. : | SYNGR2-4708H |
Product Overview : | Recombinant Human SYNGR2 protein(O43760)(168-224 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 168-224 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 8.4 kDa |
AASequence : | QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | SYNGR2 synaptogyrin 2 [ Homo sapiens ] |
Official Symbol | SYNGR2 |
Synonyms | SYNGR2; synaptogyrin 2; synaptogyrin-2; cellugyrin; MGC102914; |
Gene ID | 9144 |
mRNA Refseq | NM_004710 |
Protein Refseq | NP_004701 |
MIM | 603926 |
UniProt ID | O43760 |
◆ Recombinant Proteins | ||
RFL15829BF | Recombinant Full Length Bovine Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
RFL24390RF | Recombinant Full Length Rat Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
Syngr2-6250M | Recombinant Mouse Syngr2 Protein, Myc/DDK-tagged | +Inquiry |
SYNGR2-5526R | Recombinant Rat SYNGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25411MF | Recombinant Full Length Mouse Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNGR2 Products
Required fields are marked with *
My Review for All SYNGR2 Products
Required fields are marked with *