Recombinant Human SYNJ2BP protein, His-tagged
Cat.No. : | SYNJ2BP-9847H |
Product Overview : | Recombinant Human SYNJ2BP protein(1-112 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-112 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SYNJ2BP |
Synonyms | SYNJ2BP; synaptojanin 2 binding protein; synaptojanin-2-binding protein; activin receptor interacting protein 5; Arip2; mitochondrial outer membrane protein 25; ARIP2; OMP25; FLJ11271; FLJ41973; |
Gene ID | 55333 |
mRNA Refseq | NM_018373 |
Protein Refseq | NP_060843 |
MIM | 609411 |
UniProt ID | P57105 |
◆ Recombinant Proteins | ||
SYNJ2BP-5529R | Recombinant Rat SYNJ2BP Protein, His (Fc)-Avi-tagged | +Inquiry |
SYNJ2BP-16314M | Recombinant Mouse SYNJ2BP Protein | +Inquiry |
SYNJ2BP-5870R | Recombinant Rat SYNJ2BP Protein | +Inquiry |
SYNJ2BP-5147C | Recombinant Chicken SYNJ2BP | +Inquiry |
SYNJ2BP-10286Z | Recombinant Zebrafish SYNJ2BP | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYNJ2BP-1315HCL | Recombinant Human SYNJ2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYNJ2BP Products
Required fields are marked with *
My Review for All SYNJ2BP Products
Required fields are marked with *
0
Inquiry Basket