Recombinant Human SYNPR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYNPR-2321H |
Product Overview : | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MDPVSQLASAGTFRVLKEPLAFLRALELLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYNPR synaptoporin [ Homo sapiens (human) ] |
Official Symbol | SYNPR |
Synonyms | SYNPR; synaptoporin; SPO; synaptoporin; |
Gene ID | 132204 |
mRNA Refseq | NM_001130003 |
Protein Refseq | NP_001123475 |
UniProt ID | Q8TBG9 |
◆ Recombinant Proteins | ||
SYNPR-5531R | Recombinant Rat SYNPR Protein, His (Fc)-Avi-tagged | +Inquiry |
SYNPR-5301H | Recombinant Human SYNPR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYNPR-4585R | Recombinant Rhesus monkey SYNPR Protein, His-tagged | +Inquiry |
Synpr-6254M | Recombinant Mouse Synpr Protein, Myc/DDK-tagged | +Inquiry |
SYNPR-2321H | Recombinant Human SYNPR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYNPR-1314HCL | Recombinant Human SYNPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNPR Products
Required fields are marked with *
My Review for All SYNPR Products
Required fields are marked with *
0
Inquiry Basket