Recombinant Human SYNPR Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SYNPR-2321H |
| Product Overview : | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein. |
| Molecular Mass : | 31.1 kDa |
| AA Sequence : | MDPVSQLASAGTFRVLKEPLAFLRALELLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SYNPR synaptoporin [ Homo sapiens (human) ] |
| Official Symbol | SYNPR |
| Synonyms | SYNPR; synaptoporin; SPO; synaptoporin; |
| Gene ID | 132204 |
| mRNA Refseq | NM_001130003 |
| Protein Refseq | NP_001123475 |
| UniProt ID | Q8TBG9 |
| ◆ Recombinant Proteins | ||
| RFL23678MF | Recombinant Full Length Mouse Synaptoporin(Synpr) Protein, His-Tagged | +Inquiry |
| SYNPR-6945C | Recombinant Chicken SYNPR | +Inquiry |
| SYNPR-4585R | Recombinant Rhesus monkey SYNPR Protein, His-tagged | +Inquiry |
| Synpr-1921R | Recombinant Rat Synpr Full Length Transmembrane protein, His-tagged | +Inquiry |
| RFL33652RF | Recombinant Full Length Rat Synaptoporin(Synpr) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYNPR-1314HCL | Recombinant Human SYNPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNPR Products
Required fields are marked with *
My Review for All SYNPR Products
Required fields are marked with *
