Recombinant Human SYNPR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYNPR-5301H |
Product Overview : | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SYNPR (Synaptoporin) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transporter activity. An important paralog of this gene is SYP. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYNPR synaptoporin [ Homo sapiens (human) ] |
Official Symbol | SYNPR |
Synonyms | SYNPR; synaptoporin; SPO; synaptoporin; |
Gene ID | 132204 |
mRNA Refseq | NM_144642 |
Protein Refseq | NP_653243 |
UniProt ID | Q8TBG9 |
◆ Recombinant Proteins | ||
SYNPR-5531R | Recombinant Rat SYNPR Protein, His (Fc)-Avi-tagged | +Inquiry |
SYNPR-8918M | Recombinant Mouse SYNPR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33652RF | Recombinant Full Length Rat Synaptoporin(Synpr) Protein, His-Tagged | +Inquiry |
SYNPR-5872R | Recombinant Rat SYNPR Protein | +Inquiry |
SYNPR-4401R | Recombinant Rhesus Macaque SYNPR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYNPR-1314HCL | Recombinant Human SYNPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNPR Products
Required fields are marked with *
My Review for All SYNPR Products
Required fields are marked with *