Recombinant Human SYNPR Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SYNPR-5301H
• Product Overview: SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SYNPR (Synaptoporin) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transporter activity. An important paralog of this gene is SYP.
• Molecular Mass: 29.2 kDa
• AA Sequence: MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SYNPR synaptoporin [ Homo sapiens (human) ]
• Official Symbol: SYNPR
• Synonyms: SYNPR; synaptoporin; SPO; synaptoporin
• Gene ID: 132204
• mRNA Refseq: NM_144642
• Protein Refseq: NP_653243
• UniProt ID: Q8TBG9