Recombinant Human Syntaxin 1A protein, 1-265aa
Cat.No. : | STX1A-13H |
Product Overview : | Recombinant human STX1A was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1-265aa |
Description : | STX1A, also as known as syntaxin 1A, is a synaptic protein implicated in docking of synaptic vesicles at presynaptic active zones. This protein plays a role in hormone and neurotransmitter exocytosis and may mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm. |
Form : | Liquid |
Molecular Mass : | 30.7 kDa (265aa) confirmed by MALDI-TOF |
AA Sequence : | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol, 1mM DTT |
References : | 1. Han X., et al. (2004) Science. 304:289-92 2. Woodbury DJ. et al. (2000) Cell Biology International. 24(11):809-18 |
Gene Name | STX1A syntaxin 1A (brain) [ Homo sapiens (human) ] |
Official Symbol | STX1A |
Synonyms | STX1A; syntaxin 1A (brain); STX1; syntaxin-1A; HPC 1; p35 1; neuron-specific antigen HPC-1; HPC-1; P35-1; SYN1A |
Gene ID | 6804 |
mRNA Refseq | NM_004603 |
Protein Refseq | NP_004594 |
MIM | 186590 |
UniProt ID | Q16623 |
◆ Recombinant Proteins | ||
STX1A-5811R | Recombinant Rat STX1A Protein | +Inquiry |
RFL33813RF | Recombinant Full Length Rat Syntaxin-1A(Stx1A) Protein, His-Tagged | +Inquiry |
STX1A-2988H | Recombinant Human STX1A Protein, MYC/DDK-tagged | +Inquiry |
STX1A-4362R | Recombinant Rhesus Macaque STX1A Protein, His (Fc)-Avi-tagged | +Inquiry |
STX1A-8838M | Recombinant Mouse STX1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX1A-1717HCL | Recombinant Human STX1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX1A Products
Required fields are marked with *
My Review for All STX1A Products
Required fields are marked with *