Recombinant Human Syntaxin 1A protein, 1-265aa

• Cat.No.: STX1A-13H
• Product Overview: Recombinant human STX1A was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 1-265aa
• Description: STX1A, also as known as syntaxin 1A, is a synaptic protein implicated in docking of synaptic vesicles at presynaptic active zones. This protein plays a role in hormone and neurotransmitter exocytosis and may mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.
• Form: Liquid
• Molecular Mass: 30.7 kDa (265aa) confirmed by MALDI-TOF
• AA Sequence: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol, 1mM DTT
• References: 1. Han X., et al. (2004) Science. 304:289-92
  2. Woodbury DJ. et al. (2000) Cell Biology International. 24(11):809-18

Gene Information

• Gene Name: STX1A syntaxin 1A (brain) [ Homo sapiens (human) ]
• Official Symbol: STX1A
• Synonyms: STX1A; syntaxin 1A (brain); STX1; syntaxin-1A; HPC 1; p35 1; neuron-specific antigen HPC-1; HPC-1; P35-1; SYN1A
• Gene ID: 6804
• mRNA Refseq: NM_004603
• Protein Refseq: NP_004594
• MIM: 186590
• UniProt ID: Q16623