Recombinant Human SYT1, His-tagged
Cat.No. : | SYT1-31491TH |
Product Overview : | Recombinant fragment corresponding to amino acids 136-382 of Human Synaptotagmin 1 with C terminal His tag; 256 amino acids with tag, Predicted MWt 29.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 247 amino acids |
Description : | The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al. |
Conjugation : | HIS |
Molecular Weight : | 29.500kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLEHHHHHH |
Sequence Similarities : | Belongs to the synaptotagmin family.Contains 2 C2 domains. |
Gene Name | SYT1 synaptotagmin I [ Homo sapiens ] |
Official Symbol | SYT1 |
Synonyms | SYT1; synaptotagmin I; SVP65, SYT; synaptotagmin-1; P65; |
Gene ID | 6857 |
mRNA Refseq | NM_001135805 |
Protein Refseq | NP_001129277 |
MIM | 185605 |
Uniprot ID | P21579 |
Chromosome Location | 12cen-q21 |
Pathway | Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Botulinum neurotoxicity, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; |
Function | 1-phosphatidylinositol binding; calcium ion binding; calcium-dependent protein binding; calmodulin binding; identical protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYT1 Products
Required fields are marked with *
My Review for All SYT1 Products
Required fields are marked with *