Recombinant Human SYT1, His-tagged

Cat.No. : SYT1-31491TH
Product Overview : Recombinant fragment corresponding to amino acids 136-382 of Human Synaptotagmin 1 with C terminal His tag; 256 amino acids with tag, Predicted MWt 29.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 247 amino acids
Description : The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al.
Conjugation : HIS
Molecular Weight : 29.500kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLEHHHHHH
Sequence Similarities : Belongs to the synaptotagmin family.Contains 2 C2 domains.
Gene Name SYT1 synaptotagmin I [ Homo sapiens ]
Official Symbol SYT1
Synonyms SYT1; synaptotagmin I; SVP65, SYT; synaptotagmin-1; P65;
Gene ID 6857
mRNA Refseq NM_001135805
Protein Refseq NP_001129277
MIM 185605
Uniprot ID P21579
Chromosome Location 12cen-q21
Pathway Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Botulinum neurotoxicity, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem;
Function 1-phosphatidylinositol binding; calcium ion binding; calcium-dependent protein binding; calmodulin binding; identical protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYT1 Products

Required fields are marked with *

My Review for All SYT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon