Recombinant Human SYT1, His-tagged

• Cat.No.: SYT1-31491TH
• Product Overview: Recombinant fragment corresponding to amino acids 136-382 of Human Synaptotagmin 1 with C terminal His tag; 256 amino acids with tag, Predicted MWt 29.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 247 amino acids
• Description: The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al.
• Conjugation: HIS
• Molecular Weight: 29.500kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNLEHHHHHH
• Sequence Similarities: Belongs to the synaptotagmin family.Contains 2 C2 domains.

Gene Information

• Gene Name: SYT1 synaptotagmin I [ Homo sapiens ]
• Official Symbol: SYT1
• Synonyms: SYT1; synaptotagmin I; SVP65, SYT; synaptotagmin-1; P65
• Gene ID: 6857
• mRNA Refseq: NM_001135805
• Protein Refseq: NP_001129277
• MIM: 185605
• Uniprot ID: P21579
• Chromosome Location: 12cen-q21
• Pathway: Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Botulinum neurotoxicity, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem
• Function: 1-phosphatidylinositol binding; calcium ion binding; calcium-dependent protein binding; calmodulin binding; identical protein binding