Recombinant Human SYT2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYT2-1913H |
Product Overview : | SYT2 MS Standard C13 and N15-labeled recombinant protein (NP_001129976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYT2 synaptotagmin II [ Homo sapiens (human) ] |
Official Symbol | SYT2 |
Synonyms | SYT2; synaptotagmin II; synaptotagmin-2; synaptotagmin 2; SytII; FLJ42519; |
Gene ID | 127833 |
mRNA Refseq | NM_001136504 |
Protein Refseq | NP_001129976 |
MIM | 600104 |
UniProt ID | Q8N9I0 |
◆ Recombinant Proteins | ||
SYT2-4406R | Recombinant Rhesus Macaque SYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10500MF | Recombinant Full Length Mouse Synaptotagmin-2(Syt2) Protein, His-Tagged | +Inquiry |
SYT2-3083H | Recombinant Human SYT2, GST-tagged | +Inquiry |
Syt2-6259M | Recombinant Mouse Syt2 Protein, Myc/DDK-tagged | +Inquiry |
SYT2-4590R | Recombinant Rhesus monkey SYT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYT2-646HCL | Recombinant Human SYT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYT2 Products
Required fields are marked with *
My Review for All SYT2 Products
Required fields are marked with *
0
Inquiry Basket