Recombinant Human TAAR6 Protein, GST-tagged
Cat.No. : | TAAR6-663H |
Product Overview : | Recombinant Human TAAR6 Full-Length ORF Protein (1-345 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-345 aa |
Description : | The TAAR6 (TRAR4) gene belongs to the trace amine receptor family. Trace amines are endogenous amine compounds that are chemically similar to classic biogenic amines like dopamine, norepinephrine, serotonin, and histamine. Trace amines were thought to be 'false transmitters' that displace classic biogenic amines from their storage and act on transporters in a fashion similar to the amphetamines, but the identification of brain receptors specific to trace amines indicates that they also have effects of their own. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 64.9 kDa |
AA Sequence : | MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TAAR6 trace amine associated receptor 6 [ Homo sapiens (human) ] |
Official Symbol | TAAR6 |
Synonyms | RP11-295F4.3; SCZD5; TA4; TRAR4; |
Gene ID | 319100 |
mRNA Refseq | NM_175067 |
Protein Refseq | NP_778237 |
UniProt ID | Q96RI8 |
◆ Recombinant Proteins | ||
TAAR6-5550R | Recombinant Rat TAAR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAAR6-676H | Recombinant Human TAAR6 Protein | +Inquiry |
RFL18209RF | Recombinant Full Length Rat Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged | +Inquiry |
RFL21343HF | Recombinant Full Length Human Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged | +Inquiry |
TAAR6-5891R | Recombinant Rat TAAR6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAAR6 Products
Required fields are marked with *
My Review for All TAAR6 Products
Required fields are marked with *