Recombinant Human TACSTD2

Cat.No. : TACSTD2-30080TH
Product Overview : Recombinant fragment of Human TACD2 with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Placenta, pancreatic carcinoma cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDP EGRFKARQCNQTSVCWCVNSVGVRRTDKGD
Sequence Similarities : Belongs to the EPCAM family.Contains 1 thyroglobulin type-1 domain.
Gene Name TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ]
Official Symbol TACSTD2
Synonyms TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2;
Gene ID 4070
mRNA Refseq NM_002353
Protein Refseq NP_002344
MIM 137290
Uniprot ID P09758
Chromosome Location 1p32
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TACSTD2 Products

Required fields are marked with *

My Review for All TACSTD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon