Recombinant Human TAGLN2 protein, His-tagged
Cat.No. : | TAGLN2-3834H |
Product Overview : | Recombinant Human TAGLN2 protein(4-130 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 4-130 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TAGLN2 transgelin 2 [ Homo sapiens ] |
Official Symbol | TAGLN2 |
Synonyms | TAGLN2; transgelin 2; transgelin-2; HA1756; KIAA0120; SM22 alpha homolog; SM22-alpha homolog; |
Gene ID | 8407 |
mRNA Refseq | NM_003564 |
Protein Refseq | NP_003555 |
MIM | 604634 |
UniProt ID | P37802 |
◆ Recombinant Proteins | ||
TAGLN2-5920R | Recombinant Rat TAGLN2 Protein | +Inquiry |
TAGLN2-336H | Recombinant Human TAGLN2 Protein, His-tagged | +Inquiry |
TAGLN2-3110H | Recombinant Human TAGLN2, GST-tagged | +Inquiry |
TAGLN2-3550H | Recombinant Human TAGLN2 protein, His-SUMO-tagged | +Inquiry |
TAGLN2-315HFL | Active Recombinant Full Length Human TAGLN2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAGLN2-1261HCL | Recombinant Human TAGLN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAGLN2 Products
Required fields are marked with *
My Review for All TAGLN2 Products
Required fields are marked with *