Recombinant Human TAL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TAL2-5159H |
Product Overview : | TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. |
Molecular Mass : | 12.3 kDa |
AA Sequence : | MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TAL2 T-cell acute lymphocytic leukemia 2 [ Homo sapiens (human) ] |
Official Symbol | TAL2 |
Synonyms | TAL2; T-cell acute lymphocytic leukemia 2; T-cell acute lymphocytic leukemia protein 2; bHLHa19; TAL-2; class A basic helix-loop-helix protein 19; |
Gene ID | 6887 |
mRNA Refseq | NM_005421 |
Protein Refseq | NP_005412 |
MIM | 186855 |
UniProt ID | Q16559 |
◆ Recombinant Proteins | ||
TAL2-11484Z | Recombinant Zebrafish TAL2 | +Inquiry |
TAL2-5159H | Recombinant Human TAL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAL2-4430R | Recombinant Rhesus Macaque TAL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tal2-6287M | Recombinant Mouse Tal2 Protein, Myc/DDK-tagged | +Inquiry |
TAL2-4614R | Recombinant Rhesus monkey TAL2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAL2-1258HCL | Recombinant Human TAL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAL2 Products
Required fields are marked with *
My Review for All TAL2 Products
Required fields are marked with *