Recombinant Human TAOK3 protein, GST-tagged
| Cat.No. : | TAOK3-3668H |
| Product Overview : | Recombinant Human TAOK3 protein(366-430 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 366-430 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TAOK3 TAO kinase 3 [ Homo sapiens ] |
| Official Symbol | TAOK3 |
| Synonyms | TAOK3; TAO kinase 3; serine/threonine-protein kinase TAO3; DPK; JIK; MAP3K18; hKFC-A; STE20-like kinase; JNK/SAPK-inhibitory kinase; jun kinase-inhibitory kinase; kinase from chicken homolog A; CTCL-associated antigen HD-CL-09; dendritic cell-derived protein kinase; thousand and one amino acid protein 3; cutaneous T-cell lymphoma-associated antigen HD-CL-09; FLJ31808; DKFZp666H245; |
| Gene ID | 51347 |
| mRNA Refseq | NM_016281 |
| Protein Refseq | NP_057365 |
| UniProt ID | Q9H2K8 |
| ◆ Recombinant Proteins | ||
| TAOK3-5585R | Recombinant Rat TAOK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAOK3-16419M | Recombinant Mouse TAOK3 Protein | +Inquiry |
| TAOK3-5341H | Recombinant Human TAOK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TAOK3-3668H | Recombinant Human TAOK3 protein, GST-tagged | +Inquiry |
| TAOK3-1110H | Recombinant Human TAO Kinase 3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAOK3-587HCL | Recombinant Human TAOK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAOK3 Products
Required fields are marked with *
My Review for All TAOK3 Products
Required fields are marked with *
