Recombinant Human TAOK3 protein, GST-tagged
| Cat.No. : | TAOK3-3668H |
| Product Overview : | Recombinant Human TAOK3 protein(366-430 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | September 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 366-430 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TAOK3 TAO kinase 3 [ Homo sapiens ] |
| Official Symbol | TAOK3 |
| Synonyms | TAOK3; TAO kinase 3; serine/threonine-protein kinase TAO3; DPK; JIK; MAP3K18; hKFC-A; STE20-like kinase; JNK/SAPK-inhibitory kinase; jun kinase-inhibitory kinase; kinase from chicken homolog A; CTCL-associated antigen HD-CL-09; dendritic cell-derived protein kinase; thousand and one amino acid protein 3; cutaneous T-cell lymphoma-associated antigen HD-CL-09; FLJ31808; DKFZp666H245; |
| Gene ID | 51347 |
| mRNA Refseq | NM_016281 |
| Protein Refseq | NP_057365 |
| UniProt ID | Q9H2K8 |
| ◆ Recombinant Proteins | ||
| TAOK3-733H | Recombinant Human TAO Kinase 3 | +Inquiry |
| TAOK3-1110H | Recombinant Human TAO Kinase 3, GST-tagged | +Inquiry |
| TAOK3-3112H | Recombinant Human TAOK3 protein, His-tagged | +Inquiry |
| TAOK3-5585R | Recombinant Rat TAOK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAOK3-3904HF | Active Recombinant Full Length Human TAOK3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAOK3-587HCL | Recombinant Human TAOK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAOK3 Products
Required fields are marked with *
My Review for All TAOK3 Products
Required fields are marked with *
