Recombinant Human TARS2 Protein (369-718 aa), His-SUMO-tagged
Cat.No. : | TARS2-824H |
Product Overview : | Recombinant Human TARS2 Protein (369-718 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 369-718 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 55.3 kDa |
AA Sequence : | EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TARS2 threonyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ] |
Official Symbol | TARS2 |
Synonyms | TARS2; FLJ12528; mitochondrial; thrRS; TARSL1; |
Gene ID | 80222 |
mRNA Refseq | NM_025150 |
Protein Refseq | NP_079426 |
MIM | 612805 |
UniProt ID | Q9BW92 |
◆ Recombinant Proteins | ||
TARS2-824H | Recombinant Human TARS2 Protein (369-718 aa), His-SUMO-tagged | +Inquiry |
TARS2-8991M | Recombinant Mouse TARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TARS2-5930R | Recombinant Rat TARS2 Protein | +Inquiry |
TARS2-2750H | Recombinant Human TARS2 Protein, His-tagged | +Inquiry |
Tars2-2113R | Recombinant Rat Tars2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TARS2-1250HCL | Recombinant Human TARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARS2 Products
Required fields are marked with *
My Review for All TARS2 Products
Required fields are marked with *