Recombinant Human TARS2 Protein (369-718 aa), His-SUMO-tagged
| Cat.No. : | TARS2-824H |
| Product Overview : | Recombinant Human TARS2 Protein (369-718 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 369-718 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 55.3 kDa |
| AA Sequence : | EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | TARS2 threonyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ] |
| Official Symbol | TARS2 |
| Synonyms | TARS2; FLJ12528; mitochondrial; thrRS; TARSL1; |
| Gene ID | 80222 |
| mRNA Refseq | NM_025150 |
| Protein Refseq | NP_079426 |
| MIM | 612805 |
| UniProt ID | Q9BW92 |
| ◆ Recombinant Proteins | ||
| TARS2-5930R | Recombinant Rat TARS2 Protein | +Inquiry |
| Tars2-2112M | Recombinant Mouse Tars2 Protein, His-tagged | +Inquiry |
| TARS2-5589R | Recombinant Rat TARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TARS2-2750H | Recombinant Human TARS2 Protein, His-tagged | +Inquiry |
| Tars2-2113R | Recombinant Rat Tars2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TARS2-1250HCL | Recombinant Human TARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARS2 Products
Required fields are marked with *
My Review for All TARS2 Products
Required fields are marked with *
