Recombinant Human TATDN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TATDN3-3875H |
Product Overview : | TATDN3 MS Standard C13 and N15-labeled recombinant protein (NP_001036018) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Putative deoxyribonuclease. |
Molecular Mass : | 30.3 kDa |
AA Sequence : | MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TATDN3 TatD DNase domain containing 3 [ Homo sapiens (human) ] |
Official Symbol | TATDN3 |
Synonyms | TATDN3; TatD DNase domain containing 3; putative deoxyribonuclease TATDN3; MGC142198; |
Gene ID | 128387 |
mRNA Refseq | NM_001042553 |
Protein Refseq | NP_001036018 |
UniProt ID | Q17R31 |
◆ Recombinant Proteins | ||
TATDN3-3875H | Recombinant Human TATDN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TATDN3-6771H | Recombinant Human TatD DNase Domain Containing 3, His-tagged | +Inquiry |
TATDN3-2753Z | Recombinant Zebrafish TATDN3 | +Inquiry |
Tatdn3-6299M | Recombinant Mouse Tatdn3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TATDN3-1236HCL | Recombinant Human TATDN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TATDN3 Products
Required fields are marked with *
My Review for All TATDN3 Products
Required fields are marked with *