Recombinant Human TATDN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TATDN3-3875H
• Product Overview: TATDN3 MS Standard C13 and N15-labeled recombinant protein (NP_001036018) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Putative deoxyribonuclease.
• Molecular Mass: 30.3 kDa
• AA Sequence: MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TATDN3 TatD DNase domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: TATDN3
• Synonyms: TATDN3; TatD DNase domain containing 3; putative deoxyribonuclease TATDN3; MGC142198
• Gene ID: 128387
• mRNA Refseq: NM_001042553
• Protein Refseq: NP_001036018
• UniProt ID: Q17R31