Recombinant Human TATDN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TATDN3-3875H
Product Overview : TATDN3 MS Standard C13 and N15-labeled recombinant protein (NP_001036018) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Putative deoxyribonuclease.
Molecular Mass : 30.3 kDa
AA Sequence : MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TATDN3 TatD DNase domain containing 3 [ Homo sapiens (human) ]
Official Symbol TATDN3
Synonyms TATDN3; TatD DNase domain containing 3; putative deoxyribonuclease TATDN3; MGC142198;
Gene ID 128387
mRNA Refseq NM_001042553
Protein Refseq NP_001036018
UniProt ID Q17R31

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TATDN3 Products

Required fields are marked with *

My Review for All TATDN3 Products

Required fields are marked with *

0
cart-icon