Recombinant Human TAX1BP3, His-tagged

Cat.No. : TAX1BP3-28609TH
Product Overview : Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 124 amino acids
Description : Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene.
Conjugation : HIS
Molecular Weight : 15.800kDa inclusive of tags
Tissue specificity : Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS
Sequence Similarities : Contains 1 PDZ (DHR) domain.
Gene Name TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ]
Official Symbol TAX1BP3
Synonyms TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1;
Gene ID 30851
mRNA Refseq NM_001204698
Protein Refseq NP_001191627
Uniprot ID O14907
Chromosome Location 17p13
Pathway Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function beta-catenin binding; protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAX1BP3 Products

Required fields are marked with *

My Review for All TAX1BP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon