Recombinant Human TAX1BP3, His-tagged
| Cat.No. : | TAX1BP3-28609TH |
| Product Overview : | Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 124 amino acids |
| Description : | Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene. |
| Conjugation : | HIS |
| Molecular Weight : | 15.800kDa inclusive of tags |
| Tissue specificity : | Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS |
| Sequence Similarities : | Contains 1 PDZ (DHR) domain. |
| Gene Name | TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ] |
| Official Symbol | TAX1BP3 |
| Synonyms | TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1; |
| Gene ID | 30851 |
| mRNA Refseq | NM_001204698 |
| Protein Refseq | NP_001191627 |
| Uniprot ID | O14907 |
| Chromosome Location | 17p13 |
| Pathway | Wnt Signaling Pathway NetPath, organism-specific biosystem; |
| Function | beta-catenin binding; protein C-terminus binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAX1BP3 Products
Required fields are marked with *
My Review for All TAX1BP3 Products
Required fields are marked with *



