Recombinant Human TAX1BP3, His-tagged
Cat.No. : | TAX1BP3-28609TH |
Product Overview : | Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 124 amino acids |
Description : | Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene. |
Conjugation : | HIS |
Molecular Weight : | 15.800kDa inclusive of tags |
Tissue specificity : | Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS |
Sequence Similarities : | Contains 1 PDZ (DHR) domain. |
Gene Name | TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ] |
Official Symbol | TAX1BP3 |
Synonyms | TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1; |
Gene ID | 30851 |
mRNA Refseq | NM_001204698 |
Protein Refseq | NP_001191627 |
Uniprot ID | O14907 |
Chromosome Location | 17p13 |
Pathway | Wnt Signaling Pathway NetPath, organism-specific biosystem; |
Function | beta-catenin binding; protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
TAX1BP3-5965R | Recombinant Rat TAX1BP3 Protein | +Inquiry |
TAX1BP3-28609TH | Recombinant Human TAX1BP3, His-tagged | +Inquiry |
TAX1BP3-4742H | Recombinant Human Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3, His-tagged | +Inquiry |
TAX1BP3-1003C | Recombinant Cynomolgus TAX1BP3 Protein, His-tagged | +Inquiry |
TAX1BP3-5624R | Recombinant Rat TAX1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAX1BP3-1235HCL | Recombinant Human TAX1BP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAX1BP3 Products
Required fields are marked with *
My Review for All TAX1BP3 Products
Required fields are marked with *