Recombinant Human TBC1D10C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TBC1D10C-5512H |
Product Overview : | TBC1D10C MS Standard C13 and N15-labeled recombinant protein (NP_940919) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene has an N-terminal Rab-GTPase domain and a binding site at the C-terminus for calcineurin, and is an inhibitor of both the Ras signaling pathway and calcineurin, a phosphatase regulated by calcium and calmodulin. Genes encoding similar proteins are located on chromosomes 16 and 22. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 49.7 kDa |
AA Sequence : | MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQLAQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLLTRARGPPIEGPPRPQRGSTSFLDTRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TBC1D10C TBC1 domain family member 10C [ Homo sapiens (human) ] |
Official Symbol | TBC1D10C |
Synonyms | TBC1D10C; TBC1 domain family, member 10C; carabin; Carabin; EPI64C; FLJ00332; CARABIN; MGC46488; |
Gene ID | 374403 |
mRNA Refseq | NM_198517 |
Protein Refseq | NP_940919 |
MIM | 610831 |
UniProt ID | Q8IV04 |
◆ Recombinant Proteins | ||
TBC1D10C-5512H | Recombinant Human TBC1D10C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TBC1D10C-16478M | Recombinant Mouse TBC1D10C Protein | +Inquiry |
Tbc1d10c-396M | Recombinant Mouse Tbc1d10c Protein, MYC/DDK-tagged | +Inquiry |
TBC1D10C-4631R | Recombinant Rhesus monkey TBC1D10C Protein, His-tagged | +Inquiry |
TBC1D10C-4447R | Recombinant Rhesus Macaque TBC1D10C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBC1D10C-1231HCL | Recombinant Human TBC1D10C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBC1D10C Products
Required fields are marked with *
My Review for All TBC1D10C Products
Required fields are marked with *
0
Inquiry Basket