Recombinant Human TBC1D5 protein, His-tagged
Cat.No. : | TBC1D5-7844H |
Product Overview : | Recombinant Human TBC1D5 protein(445-795 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 445-795 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | TNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TBC1D5 TBC1 domain family, member 5 [ Homo sapiens ] |
Official Symbol | TBC1D5 |
Gene ID | 9779 |
mRNA Refseq | NM_014744.2 |
Protein Refseq | NP_055559.1 |
UniProt ID | Q92609 |
◆ Recombinant Proteins | ||
TBC1D5-16497M | Recombinant Mouse TBC1D5 Protein | +Inquiry |
Tbc1d5-6309M | Recombinant Mouse Tbc1d5 Protein, Myc/DDK-tagged | +Inquiry |
TBC1D5-8086HFL | Recombinant Full Length Human TBC1D5, Flag-tagged | +Inquiry |
TBC1D5-4079HFL | Recombinant Full Length Human TBC1D5 protein, Flag-tagged | +Inquiry |
TBC1D5-5631H | Recombinant Human TBC1D5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBC1D5 Products
Required fields are marked with *
My Review for All TBC1D5 Products
Required fields are marked with *
0
Inquiry Basket