Recombinant Human TBCB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TBCB-6220H
• Product Overview: TBCB MS Standard C13 and N15-labeled recombinant protein (NP_001272) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TBCB (Tubulin Folding Cofactor B) is a Protein Coding gene. Diseases associated with TBCB include Neuronopathy, Distal Hereditary Motor, Type Viii and Hypoparathyroidism-Retardation-Dysmorphism Syndrome. Among its related pathways are Metabolism of proteins and Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding.
• Molecular Mass: 27.3 kDa
• AA Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TBCB tubulin folding cofactor B [ Homo sapiens (human) ]
• Official Symbol: TBCB
• Synonyms: TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1, cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI; tubulin-specific chaperone B; cytoskeleton associated protein 1; cytoskeleton-associated protein 1; cytoskeleton-associated protein CKAPI; CKAP1; MGC14625
• Gene ID: 1155
• mRNA Refseq: NM_001281
• Protein Refseq: NP_001272
• MIM: 601303
• UniProt ID: Q99426