Recombinant Human TBCB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TBCB-6220H |
Product Overview : | TBCB MS Standard C13 and N15-labeled recombinant protein (NP_001272) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TBCB (Tubulin Folding Cofactor B) is a Protein Coding gene. Diseases associated with TBCB include Neuronopathy, Distal Hereditary Motor, Type Viii and Hypoparathyroidism-Retardation-Dysmorphism Syndrome. Among its related pathways are Metabolism of proteins and Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding. |
Molecular Mass : | 27.3 kDa |
AA Sequence : | MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TBCB tubulin folding cofactor B [ Homo sapiens (human) ] |
Official Symbol | TBCB |
Synonyms | TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1, cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI; tubulin-specific chaperone B; cytoskeleton associated protein 1; cytoskeleton-associated protein 1; cytoskeleton-associated protein CKAPI; CKAP1; MGC14625; |
Gene ID | 1155 |
mRNA Refseq | NM_001281 |
Protein Refseq | NP_001272 |
MIM | 601303 |
UniProt ID | Q99426 |
◆ Recombinant Proteins | ||
TBCB-3133H | Recombinant Human TBCB, GST-tagged | +Inquiry |
TBCB-565H | Recombinant Human TBCB protein(Met1-Ile244), His-tagged | +Inquiry |
TBCB-9042M | Recombinant Mouse TBCB Protein, His (Fc)-Avi-tagged | +Inquiry |
Tbcb-6311M | Recombinant Mouse Tbcb Protein, Myc/DDK-tagged | +Inquiry |
TBCB-16504M | Recombinant Mouse TBCB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCB-1219HCL | Recombinant Human TBCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBCB Products
Required fields are marked with *
My Review for All TBCB Products
Required fields are marked with *
0
Inquiry Basket