Recombinant Human TBCB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TBCB-6220H
Product Overview : TBCB MS Standard C13 and N15-labeled recombinant protein (NP_001272) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TBCB (Tubulin Folding Cofactor B) is a Protein Coding gene. Diseases associated with TBCB include Neuronopathy, Distal Hereditary Motor, Type Viii and Hypoparathyroidism-Retardation-Dysmorphism Syndrome. Among its related pathways are Metabolism of proteins and Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding.
Molecular Mass : 27.3 kDa
AA Sequence : MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TBCB tubulin folding cofactor B [ Homo sapiens (human) ]
Official Symbol TBCB
Synonyms TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1, cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI; tubulin-specific chaperone B; cytoskeleton associated protein 1; cytoskeleton-associated protein 1; cytoskeleton-associated protein CKAPI; CKAP1; MGC14625;
Gene ID 1155
mRNA Refseq NM_001281
Protein Refseq NP_001272
MIM 601303
UniProt ID Q99426

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBCB Products

Required fields are marked with *

My Review for All TBCB Products

Required fields are marked with *

0
cart-icon
0
compare icon