Recombinant Human TBCB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TBCB-6220H |
| Product Overview : | TBCB MS Standard C13 and N15-labeled recombinant protein (NP_001272) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TBCB (Tubulin Folding Cofactor B) is a Protein Coding gene. Diseases associated with TBCB include Neuronopathy, Distal Hereditary Motor, Type Viii and Hypoparathyroidism-Retardation-Dysmorphism Syndrome. Among its related pathways are Metabolism of proteins and Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding. |
| Molecular Mass : | 27.3 kDa |
| AA Sequence : | MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TBCB tubulin folding cofactor B [ Homo sapiens (human) ] |
| Official Symbol | TBCB |
| Synonyms | TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1, cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI; tubulin-specific chaperone B; cytoskeleton associated protein 1; cytoskeleton-associated protein 1; cytoskeleton-associated protein CKAPI; CKAP1; MGC14625; |
| Gene ID | 1155 |
| mRNA Refseq | NM_001281 |
| Protein Refseq | NP_001272 |
| MIM | 601303 |
| UniProt ID | Q99426 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBCB Products
Required fields are marked with *
My Review for All TBCB Products
Required fields are marked with *



