Recombinant Human TBCEL protein, GST-tagged

Cat.No. : TBCEL-30190H
Product Overview : Recombinant Human TBCEL (1-424 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Lys424
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TBCEL tubulin folding cofactor E-like [ Homo sapiens ]
Official Symbol TBCEL
Synonyms TBCEL; tubulin folding cofactor E-like; leucine rich repeat containing 35 , LRRC35, tubulin specific chaperone e like; tubulin-specific chaperone cofactor E-like protein; MGC10233; E-like; catastrophin; leucine rich repeat containing 35; tubulin-specific chaperone e-like; leucine-rich repeat-containing protein 35; El; LRRC35; FLJ14177;
Gene ID 219899
mRNA Refseq NM_001130047
Protein Refseq NP_001123519
MIM 610451
UniProt ID Q5QJ74

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBCEL Products

Required fields are marked with *

My Review for All TBCEL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon