Recombinant Human TBCEL protein, GST-tagged

• Cat.No.: TBCEL-30190H
• Product Overview: Recombinant Human TBCEL (1-424 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Lys424
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TBCEL tubulin folding cofactor E-like [ Homo sapiens ]
• Official Symbol: TBCEL
• Synonyms: TBCEL; tubulin folding cofactor E-like; leucine rich repeat containing 35 , LRRC35, tubulin specific chaperone e like; tubulin-specific chaperone cofactor E-like protein; MGC10233; E-like; catastrophin; leucine rich repeat containing 35; tubulin-specific chaperone e-like; leucine-rich repeat-containing protein 35; El; LRRC35; FLJ14177
• Gene ID: 219899
• mRNA Refseq: NM_001130047
• Protein Refseq: NP_001123519
• MIM: 610451
• UniProt ID: Q5QJ74