Recombinant Human TBCEL protein, GST-tagged
Cat.No. : | TBCEL-30190H |
Product Overview : | Recombinant Human TBCEL (1-424 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys424 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TBCEL tubulin folding cofactor E-like [ Homo sapiens ] |
Official Symbol | TBCEL |
Synonyms | TBCEL; tubulin folding cofactor E-like; leucine rich repeat containing 35 , LRRC35, tubulin specific chaperone e like; tubulin-specific chaperone cofactor E-like protein; MGC10233; E-like; catastrophin; leucine rich repeat containing 35; tubulin-specific chaperone e-like; leucine-rich repeat-containing protein 35; El; LRRC35; FLJ14177; |
Gene ID | 219899 |
mRNA Refseq | NM_001130047 |
Protein Refseq | NP_001123519 |
MIM | 610451 |
UniProt ID | Q5QJ74 |
◆ Recombinant Proteins | ||
TBCEL-7237H | Recombinant Human TBCEL, His-tagged | +Inquiry |
Tbcel-6314M | Recombinant Mouse Tbcel Protein, Myc/DDK-tagged | +Inquiry |
TBCEL-4457R | Recombinant Rhesus Macaque TBCEL Protein, His (Fc)-Avi-tagged | +Inquiry |
TBCEL-5628R | Recombinant Rat TBCEL Protein, His (Fc)-Avi-tagged | +Inquiry |
TBCEL-4523H | Recombinant Human TBCEL protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCEL-1215HCL | Recombinant Human TBCEL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBCEL Products
Required fields are marked with *
My Review for All TBCEL Products
Required fields are marked with *
0
Inquiry Basket