Recombinant Human TBXAS1 protein, His-tagged

Cat.No. : TBXAS1-7843H
Product Overview : Recombinant Human TBXAS1 protein(178-267 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 178-267 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : NKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol TBXAS1
Synonyms TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771;
Gene ID 6916
mRNA Refseq NM_001061
Protein Refseq NP_001052
MIM 274180
UniProt ID P24557

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBXAS1 Products

Required fields are marked with *

My Review for All TBXAS1 Products

Required fields are marked with *

0
cart-icon