Recombinant Human TBXAS1 protein, His-tagged
Cat.No. : | TBXAS1-7843H |
Product Overview : | Recombinant Human TBXAS1 protein(178-267 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 178-267 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | NKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TBXAS1 |
Synonyms | TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771; |
Gene ID | 6916 |
mRNA Refseq | NM_001061 |
Protein Refseq | NP_001052 |
MIM | 274180 |
UniProt ID | P24557 |
◆ Recombinant Proteins | ||
TBXAS1-3149H | Recombinant Human TBXAS1, MYC/DDK-tagged | +Inquiry |
TBXAS1-3148H | Recombinant Human TBXAS1, MYC/DDK-tagged | +Inquiry |
TBXAS1-16537M | Recombinant Mouse TBXAS1 Protein | +Inquiry |
TBXAS1-2371H | Recombinant Human TBXAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TBXAS1-750C | Recombinant Cynomolgus Monkey TBXAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBXAS1-1196HCL | Recombinant Human TBXAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBXAS1 Products
Required fields are marked with *
My Review for All TBXAS1 Products
Required fields are marked with *
0
Inquiry Basket