Recombinant Human TCEA1
Cat.No. : | TCEA1-30067TH |
Product Overview : | Recombinant full length Human TCEA1 with N terminal proprietary tag; Predicted MWt 59.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 301 amino acids |
Description : | Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene. |
Molecular Weight : | 59.180kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLEL LQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKD AKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS ADEPMTTFVVCNECGNRWKFC |
Sequence Similarities : | Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger. |
Gene Name | TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ] |
Official Symbol | TCEA1 |
Synonyms | TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS; |
Gene ID | 6917 |
mRNA Refseq | NM_006756 |
Protein Refseq | NP_006747 |
MIM | 601425 |
Uniprot ID | P23193 |
Chromosome Location | 8q11.2 |
Pathway | DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; |
Function | DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
TCEA1-10356Z | Recombinant Zebrafish TCEA1 | +Inquiry |
TCEA1-5639R | Recombinant Rat TCEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEA1-4461R | Recombinant Rhesus Macaque TCEA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEA1-30067TH | Recombinant Human TCEA1 | +Inquiry |
TCEA1-5411H | Recombinant Human TCEA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEA1 Products
Required fields are marked with *
My Review for All TCEA1 Products
Required fields are marked with *