Recombinant Human TCEAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TCEAL1-5536H
Product Overview : TCEAL1 MS Standard C13 and N15-labeled recombinant protein (NP_004771) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.
Molecular Mass : 18.6 kDa
AA Sequence : MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TCEAL1 transcription elongation factor A like 1 [ Homo sapiens (human) ]
Official Symbol TCEAL1
Synonyms TCEAL1; transcription elongation factor A (SII)-like 1; transcription elongation factor A protein-like 1; P21; p21; pp21; SIIR; TCEA-like protein 1; nuclear phosphoprotein p21/SIIR; transcription elongation factor S-II protein-like 1;
Gene ID 9338
mRNA Refseq NM_004780
Protein Refseq NP_004771
MIM 300237
UniProt ID Q15170

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCEAL1 Products

Required fields are marked with *

My Review for All TCEAL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon