Recombinant Human TCEAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TCEAL1-5536H |
Product Overview : | TCEAL1 MS Standard C13 and N15-labeled recombinant protein (NP_004771) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TCEAL1 transcription elongation factor A like 1 [ Homo sapiens (human) ] |
Official Symbol | TCEAL1 |
Synonyms | TCEAL1; transcription elongation factor A (SII)-like 1; transcription elongation factor A protein-like 1; P21; p21; pp21; SIIR; TCEA-like protein 1; nuclear phosphoprotein p21/SIIR; transcription elongation factor S-II protein-like 1; |
Gene ID | 9338 |
mRNA Refseq | NM_004780 |
Protein Refseq | NP_004771 |
MIM | 300237 |
UniProt ID | Q15170 |
◆ Recombinant Proteins | ||
TCEAL1-3536H | Recombinant Human TCEAL1 protein, His-tagged | +Inquiry |
TCEAL1-691H | Recombinant Human transcription elongation factor A (SII)-like 1, His-tagged | +Inquiry |
TCEAL1-5134H | Recombinant Human Transcription Elongation Factor A (SII)-Like 1, His-tagged | +Inquiry |
TCEAL1-5536H | Recombinant Human TCEAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TCEAL1-5982R | Recombinant Rat TCEAL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEAL1-1192HCL | Recombinant Human TCEAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEAL1 Products
Required fields are marked with *
My Review for All TCEAL1 Products
Required fields are marked with *
0
Inquiry Basket