Recombinant Human TCEAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TCEAL1-5536H
• Product Overview: TCEAL1 MS Standard C13 and N15-labeled recombinant protein (NP_004771) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.
• Molecular Mass: 18.6 kDa
• AA Sequence: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TCEAL1 transcription elongation factor A like 1 [ Homo sapiens (human) ]
• Official Symbol: TCEAL1
• Synonyms: TCEAL1; transcription elongation factor A (SII)-like 1; transcription elongation factor A protein-like 1; P21; p21; pp21; SIIR; TCEA-like protein 1; nuclear phosphoprotein p21/SIIR; transcription elongation factor S-II protein-like 1
• Gene ID: 9338
• mRNA Refseq: NM_004780
• Protein Refseq: NP_004771
• MIM: 300237
• UniProt ID: Q15170