Recombinant Human TCEB1 protein, His-tagged
Cat.No. : | TCEB1-8786H |
Product Overview : | Recombinant Human TCEB1 protein(1-112 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-112 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ] |
Official Symbol | TCEB1 |
Synonyms | TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII; SIII p15; elongin-C; elongin 15 kDa subunit; transcription elongation factor B, polypeptide 1; RNA polymerase II transcription factor SIII subunit C; eloC; |
mRNA Refseq | NM_001204857 |
Protein Refseq | NP_001191786 |
MIM | 600788 |
UniProt ID | Q15369 |
Gene ID | 6921 |
◆ Recombinant Proteins | ||
TCEB1-4467R | Recombinant Rhesus Macaque TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEB1-16550M | Recombinant Mouse TCEB1 Protein | +Inquiry |
TCEB1-9074M | Recombinant Mouse TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEB1-4651R | Recombinant Rhesus monkey TCEB1 Protein, His-tagged | +Inquiry |
TCEB1-1790C | Recombinant Chicken TCEB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEB1-1189HCL | Recombinant Human TCEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEB1 Products
Required fields are marked with *
My Review for All TCEB1 Products
Required fields are marked with *