Recombinant Human TCF7 Protein, GST-tagged
| Cat.No. : | TCF7-15H |
| Product Overview : | Human TCF7 full-length ORF ( NP_003193.2, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 68 kDa |
| AA Sequence : | MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TCF7 transcription factor 7 (T-cell specific, HMG-box) [ Homo sapiens ] |
| Official Symbol | TCF7 |
| Synonyms | TCF7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7; TCF 1; T-cell-specific transcription factor 1; TCF-1; FLJ36364; MGC47735; |
| Gene ID | 6932 |
| mRNA Refseq | NM_001134851 |
| Protein Refseq | NP_001128323 |
| MIM | 189908 |
| UniProt ID | P36402 |
| ◆ Recombinant Proteins | ||
| TCF7-9082M | Recombinant Mouse TCF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TCF7-2043Z | Recombinant Zebrafish TCF7 | +Inquiry |
| TCF7-4921H | Recombinant Human TCF7 protein(1-384aa), His&Myc-tagged | +Inquiry |
| TCF7-6116C | Recombinant Chicken TCF7 | +Inquiry |
| TCF7-119H | Recombinant Human TCF7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TCF7-1753HCL | Recombinant Human TCF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCF7 Products
Required fields are marked with *
My Review for All TCF7 Products
Required fields are marked with *
