Recombinant Human TCF7 Protein, GST-tagged
Cat.No. : | TCF7-15H |
Product Overview : | Human TCF7 full-length ORF ( NP_003193.2, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 68 kDa |
AA Sequence : | MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TCF7 transcription factor 7 (T-cell specific, HMG-box) [ Homo sapiens ] |
Official Symbol | TCF7 |
Synonyms | TCF7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7; TCF 1; T-cell-specific transcription factor 1; TCF-1; FLJ36364; MGC47735; |
Gene ID | 6932 |
mRNA Refseq | NM_001134851 |
Protein Refseq | NP_001128323 |
MIM | 189908 |
UniProt ID | P36402 |
◆ Recombinant Proteins | ||
TCF7-16564M | Recombinant Mouse TCF7 Protein | +Inquiry |
TCF7-4921H | Recombinant Human TCF7 protein(1-384aa), His&Myc-tagged | +Inquiry |
TCF7-9082M | Recombinant Mouse TCF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCF7-15H | Recombinant Human TCF7 Protein, GST-tagged | +Inquiry |
TCF7-119H | Recombinant Human TCF7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCF7-1753HCL | Recombinant Human TCF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCF7 Products
Required fields are marked with *
My Review for All TCF7 Products
Required fields are marked with *
0
Inquiry Basket