"TCF7" Related Products

Expand

Recombinant Human TCF7 Protein, GST-tagged

Cat.No. : TCF7-15H
Product Overview : Human TCF7 full-length ORF ( NP_003193.2, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 68 kDa
AA Sequence : MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name : TCF7 transcription factor 7 (T-cell specific, HMG-box) [ Homo sapiens ]
Official Symbol : TCF7
Synonyms : TCF7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7; TCF 1; T-cell-specific transcription factor 1; TCF-1; FLJ36364; MGC47735;
Gene ID : 6932
mRNA Refseq : NM_001134851
Protein Refseq : NP_001128323
MIM : 189908
UniProt ID : P36402

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.