Recombinant Human TCL1B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TCL1B-5661H |
| Product Overview : | TCL1B MS Standard C13 and N15-labeled recombinant protein (NP_004909) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TCL1B (TCL1 Family AKT Coactivator B) is a Protein Coding gene. Diseases associated with TCL1B include T-Cell Lymphoblastic Leukemia/Lymphoma and Leukemia. Among its related pathways are PI3K-Akt signaling pathway. An important paralog of this gene is MTCP1. |
| Molecular Mass : | 14.9 kDa |
| AA Sequence : | MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TCL1B T-cell leukemia/lymphoma 1B [ Homo sapiens (human) ] |
| Official Symbol | TCL1B |
| Synonyms | TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1; |
| Gene ID | 9623 |
| mRNA Refseq | NM_004918 |
| Protein Refseq | NP_004909 |
| MIM | 603769 |
| UniProt ID | O95988 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCL1B Products
Required fields are marked with *
My Review for All TCL1B Products
Required fields are marked with *



