Recombinant Human TCL1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TCL1B-5661H
Product Overview : TCL1B MS Standard C13 and N15-labeled recombinant protein (NP_004909) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TCL1B (TCL1 Family AKT Coactivator B) is a Protein Coding gene. Diseases associated with TCL1B include T-Cell Lymphoblastic Leukemia/Lymphoma and Leukemia. Among its related pathways are PI3K-Akt signaling pathway. An important paralog of this gene is MTCP1.
Molecular Mass : 14.9 kDa
AA Sequence : MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TCL1B T-cell leukemia/lymphoma 1B [ Homo sapiens (human) ]
Official Symbol TCL1B
Synonyms TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1;
Gene ID 9623
mRNA Refseq NM_004918
Protein Refseq NP_004909
MIM 603769
UniProt ID O95988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCL1B Products

Required fields are marked with *

My Review for All TCL1B Products

Required fields are marked with *

0
cart-icon