Recombinant Human TCL1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TCL1B-5661H |
Product Overview : | TCL1B MS Standard C13 and N15-labeled recombinant protein (NP_004909) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TCL1B (TCL1 Family AKT Coactivator B) is a Protein Coding gene. Diseases associated with TCL1B include T-Cell Lymphoblastic Leukemia/Lymphoma and Leukemia. Among its related pathways are PI3K-Akt signaling pathway. An important paralog of this gene is MTCP1. |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TCL1B T-cell leukemia/lymphoma 1B [ Homo sapiens (human) ] |
Official Symbol | TCL1B |
Synonyms | TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1; |
Gene ID | 9623 |
mRNA Refseq | NM_004918 |
Protein Refseq | NP_004909 |
MIM | 603769 |
UniProt ID | O95988 |
◆ Recombinant Proteins | ||
TCL1B-5661H | Recombinant Human TCL1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TCL1B-320H | Recombinant Human TCL1B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCL1B-1173HCL | Recombinant Human TCL1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCL1B Products
Required fields are marked with *
My Review for All TCL1B Products
Required fields are marked with *
0
Inquiry Basket