Recombinant Human TCOF1

Cat.No. : TCOF1-31607TH
Product Overview : Recombinant fragment of Human Treacher Collins syndrome protein with N-terminal proprietary tag.Mol Wt 34.54 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 81 amino acids
Description : This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 34.540kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
Sequence Similarities : Contains 1 LisH domain.
Gene Name TCOF1 Treacher Collins-Franceschetti syndrome 1 [ Homo sapiens ]
Official Symbol TCOF1
Synonyms TCOF1; Treacher Collins-Franceschetti syndrome 1; treacle protein; treacle;
Gene ID 6949
mRNA Refseq NM_000356
Protein Refseq NP_000347
MIM 606847
Uniprot ID Q13428
Chromosome Location 5q31.3-q33.3
Pathway Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function protein binding; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCOF1 Products

Required fields are marked with *

My Review for All TCOF1 Products

Required fields are marked with *

0
cart-icon