Recombinant Human TCTA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TCTA-3532H |
Product Overview : | TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be required for cellular fusion during osteoclastogenesis. |
Molecular Mass : | 11.3 kDa |
AA Sequence : | MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TCTA T cell leukemia translocation altered [ Homo sapiens (human) ] |
Official Symbol | TCTA |
Synonyms | TCTA; T cell leukemia translocation altered; T-cell leukemia translocation-altered gene protein; T-cell leukemia translocation-associated gene protein |
Gene ID | 6988 |
mRNA Refseq | NM_022171 |
Protein Refseq | NP_071503 |
MIM | 600690 |
UniProt ID | P57738 |
◆ Recombinant Proteins | ||
TCTA-3532H | Recombinant Human TCTA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TCTA-9093M | Recombinant Mouse TCTA Protein, His (Fc)-Avi-tagged | +Inquiry |
TCTA-5654R | Recombinant Rat TCTA Protein, His (Fc)-Avi-tagged | +Inquiry |
TCTA-16588M | Recombinant Mouse TCTA Protein | +Inquiry |
TCTA-703Z | Recombinant Zebrafish TCTA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCTA-1164HCL | Recombinant Human TCTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCTA Products
Required fields are marked with *
My Review for All TCTA Products
Required fields are marked with *
0
Inquiry Basket