Recombinant Human TCTA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TCTA-3532H
• Product Overview: TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May be required for cellular fusion during osteoclastogenesis.
• Molecular Mass: 11.3 kDa
• AA Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TCTA T cell leukemia translocation altered [ Homo sapiens (human) ]
• Official Symbol: TCTA
• Synonyms: TCTA; T cell leukemia translocation altered; T-cell leukemia translocation-altered gene protein; T-cell leukemia translocation-associated gene protein
• Gene ID: 6988
• mRNA Refseq: NM_022171
• Protein Refseq: NP_071503
• MIM: 600690
• UniProt ID: P57738