Recombinant Human TCTA Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TCTA-3532H |
| Product Overview : | TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May be required for cellular fusion during osteoclastogenesis. |
| Molecular Mass : | 11.3 kDa |
| AA Sequence : | MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TCTA T cell leukemia translocation altered [ Homo sapiens (human) ] |
| Official Symbol | TCTA |
| Synonyms | TCTA; T cell leukemia translocation altered; T-cell leukemia translocation-altered gene protein; T-cell leukemia translocation-associated gene protein |
| Gene ID | 6988 |
| mRNA Refseq | NM_022171 |
| Protein Refseq | NP_071503 |
| MIM | 600690 |
| UniProt ID | P57738 |
| ◆ Cell & Tissue Lysates | ||
| TCTA-1164HCL | Recombinant Human TCTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCTA Products
Required fields are marked with *
My Review for All TCTA Products
Required fields are marked with *
