Recombinant Human TDG Protein, His-tagged
Cat.No. : | TDG-122H |
Product Overview : | Recombinant Human TDG Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaired thymine. With lower activity, this enzyme also removes thymine from C/T and T/T mispairings. TDG can also remove uracil and 5-bromouracil from mispairings with guanine. This enzyme plays a central role in cellular defense against genetic mutation caused by the spontaneous deamination of 5-methylcytosine and cytosine. This gene may have a pseudogene in the p arm of chromosome 12. |
Form : | 50mM Tris, 300mM NaCl, pH8.0. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MDDATNKKRKVFVSTILTFWNTDRRDFPWRHTRDPYVILITEILLRRTTAGHVKKIYDKFFVKYKCFEDILKTPKSEIAKDIKEIGLSNQRAEQLKELARVVINDYGGRVPRNRKAILDLPGVGKYTCAAVMCLAFGKKAAMVDANFVRVINRYFGGSYENLNYNHKALWELAETLVPGGKCRDFNLGLMDFSAIICAPRKPKCEKCGMSKLCSYYEKCSTLEHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.2 mg/ml |
Gene Name | TDG thymine DNA glycosylase [ Homo sapiens (human) ] |
Official Symbol | TDG |
Synonyms | hTDG |
Gene ID | 6996 |
mRNA Refseq | NM_001363612 |
Protein Refseq | NP_001350541 |
MIM | 601423 |
UniProt ID | Q13569 |
◆ Recombinant Proteins | ||
TDG-7443H | Human TDG protein | +Inquiry |
TDG-6315C | Recombinant Chicken TDG | +Inquiry |
TDG-4169H | Recombinant Human TDG Protein, His (Fc)-Avi-tagged | +Inquiry |
TDG-10H | Recombinant Human TDG protein, His-SUMO-tagged | +Inquiry |
TDG-122H | Recombinant Human TDG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDG-1157HCL | Recombinant Human TDG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDG Products
Required fields are marked with *
My Review for All TDG Products
Required fields are marked with *
0
Inquiry Basket