Recombinant Human TDO2 protein, His-SUMO-tagged
| Cat.No. : | TDO2-3557H |
| Product Overview : | Recombinant Human TDO2 protein(P48775)(1-406aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-406aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 63.9 kDa |
| AA Sequence : | MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens ] |
| Official Symbol | TDO2 |
| Synonyms | TDO2; tryptophan 2,3-dioxygenase; TDO; TPH2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; TO; TRPO; |
| Gene ID | 6999 |
| mRNA Refseq | NM_005651 |
| Protein Refseq | NP_005642 |
| MIM | 191070 |
| UniProt ID | P48775 |
| ◆ Recombinant Proteins | ||
| TDO2-724H | Recombinant Human TDO2 protein, His-tagged | +Inquiry |
| TDO2-1535H | Recombinant Human TDO2 Protein (1-406 aa), His-tagged | +Inquiry |
| TDO25033H | Recombinant Human TDO2 (39-389) Protein | +Inquiry |
| TDO216711H | Recombinant Human TDO2 (1-406) Protein | +Inquiry |
| TDO2-3171H | Recombinant Human TDO2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDO2 Products
Required fields are marked with *
My Review for All TDO2 Products
Required fields are marked with *



