Recombinant Human TDP1 Protein, GST-tagged
| Cat.No. : | TDP1-3325H |
| Product Overview : | Recombinant Human TDP1 Protein (1-608 AA) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-608 AA |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 92.62 kDa |
| AA Sequence : | MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TDP1 tyrosyl-DNA phosphodiesterase 1 [ Homo sapiens ] |
| Official Symbol | TDP1 |
| Synonyms | TDP1; tyrosyl-DNA phosphodiesterase 1; FLJ11090; SCAN1; tyr-DNA phosphodiesterase 1; MGC104252; |
| Gene ID | 55775 |
| mRNA Refseq | NM_001008744 |
| Protein Refseq | NP_001008744 |
| MIM | 607198 |
| UniProt ID | Q9NUW8 |
| ◆ Recombinant Proteins | ||
| TDP1-3326H | Recombinant Human TDP1 Protein, Flag-tagged | +Inquiry |
| Tdp1-1668R | Recombinant Rat Tdp1 protein, His & GST-tagged | +Inquiry |
| TDP1-6799HF | Recombinant Full Length Human TDP1 Protein, GST-tagged | +Inquiry |
| TDP1-3328H | Active Recombinant Human TDP1 Protein | +Inquiry |
| TDP1-5998R | Recombinant Rat TDP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TDP1-1155HCL | Recombinant Human TDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDP1 Products
Required fields are marked with *
My Review for All TDP1 Products
Required fields are marked with *



