Recombinant Human TDP1 Protein, GST-tagged
Cat.No. : | TDP1-3325H |
Product Overview : | Recombinant Human TDP1 Protein (1-608 AA) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-608 AA |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 92.62 kDa |
AA Sequence : | MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TDP1 tyrosyl-DNA phosphodiesterase 1 [ Homo sapiens ] |
Official Symbol | TDP1 |
Synonyms | TDP1; tyrosyl-DNA phosphodiesterase 1; FLJ11090; SCAN1; tyr-DNA phosphodiesterase 1; MGC104252; |
Gene ID | 55775 |
mRNA Refseq | NM_001008744 |
Protein Refseq | NP_001008744 |
MIM | 607198 |
UniProt ID | Q9NUW8 |
◆ Recombinant Proteins | ||
TDP1-2334H | Recombinant Human TDP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tdp1-1668R | Recombinant Rat Tdp1 protein, His & GST-tagged | +Inquiry |
TDP1-01H | Recombinant Human TDP1 Protein, His-Tagged | +Inquiry |
TDP1-4660R | Recombinant Rhesus monkey TDP1 Protein, His-tagged | +Inquiry |
TDP1-3327H | Recombinant Human TDP1 Protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDP1-1155HCL | Recombinant Human TDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDP1 Products
Required fields are marked with *
My Review for All TDP1 Products
Required fields are marked with *